PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim06g062520.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 193aa    MW: 20973.9 Da    PI: 8.275
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim06g062520.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.57.2e-391877362
              zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                        ++ lkcprCds ntkfCyynny+lsqPr+fCk+C+ryWtkGG lrn+PvGg++rkn k+s
  Sopim06g062520.0.1 18 QQVLKCPRCDSINTKFCYYNNYNLSQPRHFCKNCKRYWTKGGILRNIPVGGSSRKNTKRS 77
                        6889****************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-24968IPR003851Zinc finger, Dof-type
PfamPF027011.6E-331975IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.6212175IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102359IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MQDPSSIYSQ INPQFPDQQV LKCPRCDSIN TKFCYYNNYN LSQPRHFCKN CKRYWTKGGI  60
LRNIPVGGSS RKNTKRSSSN SCKRSSTMTI SSSTSSEQNS KTEHFDTPVV RNSPIVDANG  120
PFGSLLASNG PEIGNFLNVL NPNGPDSGSD AAAAQSGNSN NNHEFLGEDS NCWNGTNGWA  180
DLAIYTPGST FQ*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00199DAPTransfer from AT1G51700Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2192240.0AC219224.1 Solanum lycopersicum chromosome 6 clone C06SLm0074G21, complete sequence.
GenBankHG9755180.0HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004241941.11e-141PREDICTED: dof zinc finger protein DOF3.1-like
SwissprotO821551e-41DOF17_ARATH; Dof zinc finger protein DOF1.7
TrEMBLK4C6Y31e-141K4C6Y3_SOLLC; Uncharacterized protein
STRINGSolyc06g062520.1.11e-140(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.16e-34DOF zinc finger protein 1